<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
518 CS_518 Cote d'Ivoire 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 D4T|DDI|IDV 163

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI I13V, K14R, K20I, M36I, R41K, L63S, H69K, V82I, L89M  
>CS_518| codons 11-99
ITVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQISIEICGKK
AIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49R, E53D, V60VI, I135V, S162A, K173A, Q174K, D177E, I178M, T200A, Q207E, V245Q  
>CS_518| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISRIGPDNPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDI

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007