<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
293 CS_293 Cote d'Ivoire 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NFV 150

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KN, M184MV K70KQ     E6D, K11KT, V35T, E36A, T39K, K43E, I47IL, V60I, K122E, D123S, I135AT, I142V, S162SY, K173S, D177E, V179I, T200A, Q207A, E224D, V245Q  
>CS_293| codons 1-274
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKLSKIGPENPYNTPI
FAIKNKDSTQWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSQNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKDPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88NS V11VI L10M, T12TA, I13V, K14R, G16E, K20KI, E35D, M36I, R41K, K43KR, H69K, I72IR, L89MT  
>CS_293| codons 1-99
PQITLWQRPMIAVRIEGQLIEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKARGTVLVGPTPVNIIGRSTLTQIGCTLNF

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007