<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
292 CS_292 Cote d'Ivoire 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|EFV|IDV 101

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I L10V, T12A, I13V, K14KR, G16E, K20R, M36I, R41K, L63T, H69K, K70R, L89M  
>CS_292| codons 1-99
PQITLWQRPVVAVRIEGQLREALLDTGADDTVIEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103KN   V35I, D121Y, K122E, I135L, I159IV, S162A, K173T, Q174K, T200A, Q207E, R211K, V245Q  
>CS_292| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAVFQASMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDI

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007