<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
205 CS_205 Cote d'Ivoire 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV|IDV 209

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89MV I13V, K14R, G16E, K20I, E35D, M36I, R41K, I64M, H69K, K70KR  
>CS_205| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215TFIS K219Q K103N, M230L P225H V35T, E36A, T39K, K43E, K64KR, T69TAS, D123E, S162A, K173A, Q174K, D177E, T200TA, Q207A, R211K, L228R, P243H, V245Q  
>CS_205| codons 1-271
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIRKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFSTPDQKHQKEHPFRWLGYELHPDKWT
VQHIQLPEKDSWTVNDIQKLVGKLNWASQIY

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007