<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
179 CS_179 Cote d'Ivoire 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|EFV|IDV 119

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10I, I13V, G16E, K20I, M36I, N37ND, R41K, L63T, H69K, K70KR, A71T, L89M, I93L  
>CS_179| codons 1-99
PQITLWQRPIITVKIEGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKRTIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007