<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
126 CS_126 Cote d'Ivoire 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|EFV 112

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, K20I, M36I, R41K, L63LP, H69K, K70R, L89M  
>CS_126| codons 1-99
PQITLWQRPVVTVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, T39M, V60I, K102E, I135V, S162Y, K173T, Q174K, D177DE, T200A, E204Q, Q207E Y127F
>CS_126| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKENKSVTVLDVGDAYFSVPL
DKDFRKFTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEQLREHLLRWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007