<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
006 CS_006 Cote d'Ivoire 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDC|DDI|IDV|NFV 204

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73GS L10LV, I13V, K14R, I15V, K20I, E35DN, M36I, N37ND, R41RK, I64IM, H69K, A71AV, L89MT  
>CS_006| codons 1-99
PQITLWQRPVVTVRVGGQLIEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKVISTVLVGPTPVNIIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, M184V, L210LW T215S, K219N     K22R, V35T, T39TA, W88C, K122E, D123N, I135L, S162A, T165TI, E169Q, K173T, Q174K, D177E, I178M, E194ED, G196E, Q197QP, T200A, E203D, R211K, F214FC, K238KE N137NK, R143RK, G152GE, H235HL
>CS_006| codons 1-240
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNKETPGIKYQYNVLPQEWKGSPAIFQASMIKILQPFRTKNPEMVI
YQYVDDLYVGSDLDIEPHRAKIDELRQHLWKWGCSTPDNKHQKEPPFLWMGYELLPDEWT

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007