<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2255 CA8400 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI 29
2 3TC+DDI+SQV 12
3 3TC+DDI+IDV 51
4 D4T+IDV+NVP 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73GC L10I, K20I, L63LP, I64IV, T74S, V77I, I85V  
>CA8400| codons 10-99
IVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQILIEICGH
KAICSVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, Q151M K219Q K103N, Y181YC, G190GA   I31IL, V60I, D123E, K166R, D177E, T200I, I202V, R211K, H221HY, V245T, D250E, A272P, K277R, I293V  
>CA8399| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYMDDLYVASDLEIGQHRIKVEELRQHLLKWGFTTPDQKYQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005