<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2312 CA8395 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+ 3TC 17
3 AZT+ 3TC+ IDV 148

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A L10F E35D, L63P, I64V, H69Y, A71V  
>CA8395| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTILEDMNLPGRWKPKLIGGIGGFIKVRQYD
QIPVEICGYKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215NY       I135V, I142V, S162C, R211K L234LH
>CA8394| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFNTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001