<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6 AZ_6 Unknown 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|ABC|AZT NA
2 ATV+DDI+RTV+TDF 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50ILM   N37DE, L63S, A71V, I72Q, V77I, I93L  
>AZ_6| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGLGGFIKVRQYD
QISIEICGHKVQGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Zolopa, A Resistance profile after viral rebound on atazanavir-containing therapy: focus on protease inhibitor naive subjects in the IMPACT study (BMS AI424-128). IHDRW 2007, 2007