<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|ABC|AZT NA
2 ATV+DDI+RTV+TDF 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50ILM   N37DE, L63S, A71V, I72Q, V77I, I93L  
>AZ_6| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGLGGFIKVRQYD
QISIEICGHKVQGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Zolopa, A Resistance profile after viral rebound on atazanavir-containing therapy: focus on protease inhibitor naive subjects in the IMPACT study (BMS AI424-128). IHDRW 2007, 2007