<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 AZ_4 Unknown 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|EFV NA
2 3TC+ATV+AZT+RTV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50IL N88NT L10V, I15V, G16E, A71AT, I72R  
>AZ_4| codons 1-99
PQITLWQRPVVTIKVEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGLGGFIKVRQYD
QILIEICGHKTRGTVLVGPTPVNIIGRTLLTQIGCTLNF

References
Author Title Citation
Zolopa, A Resistance profile after viral rebound on atazanavir-containing therapy: focus on protease inhibitor naive subjects in the IMPACT study (BMS AI424-128). IHDRW 2007, 2007