<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3 AZ_3 Unknown 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|ABC|AZT|NVP NA
2 3TC+ABC+ATV+AZT 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   T12K, L19V, K20KT, E34EQ, E35D, M36MV, N37X, R41K, K45R, R57K, L63P, I64L, A71T, V77I, I93L  
>AZ_3| codons 1-99
PQITLWQRPLVKIKIGGQVTEALLDTGADDTVLQDVHLPGKWKPRMIGGIGGFIKVKQYD
QIPLEICGHKTIGTVLIGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Zolopa, A Resistance profile after viral rebound on atazanavir-containing therapy: focus on protease inhibitor naive subjects in the IMPACT study (BMS AI424-128). IHDRW 2007, 2007