<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 AZ_2 Unknown 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ATV+RTV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L L33F E35D, M36I, N37D, K45I, L63T G78GR
>AZ_2| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVFEDIDLPGRWKPIMIGGLGGFIKVRQYD
QITIEICGHKAIGTVLVRPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Zolopa, A Resistance profile after viral rebound on atazanavir-containing therapy: focus on protease inhibitor naive subjects in the IMPACT study (BMS AI424-128). IHDRW 2007, 2007