<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ATV+D4T 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L, N88NS L33LF L10I, I15V, G16E, K20KIT, E35D, M36MV, L63H, A71AV, V77VI, L89M L23LP
>DMG_8a| codons 1-99
PQITLWQRPIVTIKVEGQLIEAPLDTGADDTVFEDVNLPGRWKPKMIGGLGGFIKVRQYD
QIHIEICGHKVIGTVLIGPTPVNIIGRSMLTQIGCTLNF

References
Author Title Citation
McGrath, D Antiviral efficacy and emergent PI substitutions in treatment-naive subjects receiving atazanavir +/- ritonavir-based HAART in subtype b and non-type b HIV-1 infection. IHDRW 2007, 2007