<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 DMG_7 U.S. 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16GE, L19T, K20R, M36I, R41K, L63AITV, I64IM, E65D, H69K, L89M, I93L  
>DMG_7| codons 1-99
PQITLWQRPIVTVKIEGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAMDICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Malan DR 96-week efficacy and safety of atazanavir, with and without ritonavir, in a HAART regimen in treatment-naive patients. J Int Assoc Physicians AIDS Care, 2010