<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1408 CA8383 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 7
2 AZT 77
3 D4T+DDC 24
4 3TC+AZT+IDV 46
5 3TC+AZT+DDC+IDV 7
6 D4T+DDI+NFV 30
7 3TC+DDI+NFV 28
8 3TC+DDI+NFV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10V, I13V, K20KR, E35D, N37D, I62V, L63P, I64V, A71T, I72V, V77I, I93L  
>CA8383| codons 1-99
PQITLWQRPVVTVKIGGQLREALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKTVGTVLIGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70E, Q151M, M184V F116Y     K20R, I31IL, V60I, I135T, E138ED, T200A, R211K, F214FL K49K*
>CA8382| codons 1-234
PISPIETVPVKLKPGMDGPRVKQWPLTEEKLKALVEICTEMEKEGKIS*IGPENPYNTPI
FAIKKKNSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSTNNDTPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005