<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU90 90FMAR04 Kenya 2004 HIV1 D Plasma MC

Treatment History
Order Regimen Weeks
1 NVP 1
2 3TC+AZT+NVP 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K32I, V35T, K49R, V60I, D121Y, K122E, I135T, T139K, S162C, D177E, T200I, Q207G, R211K  
>90FMAR04| 01 | codons 1-220 | clone 01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 03 | codons 1-220 | clone 03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 07 | codons 1-220 | clone 07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 12 | codons 1-220 | clone 12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 15 | codons 1-220 | clone 15
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAILQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 16 | codons 1-220 | clone 16
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 17 | codons 1-220 | clone 17
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 18 | codons 1-220 | clone 18
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| 19 | codons 1-220 | clone 19
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FMAR04| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007