<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU90 90FAPR03 Kenya 2003 HIV1 D Plasma MC

Treatment History
Order Regimen Weeks
1 NVP 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   K32I, V35T, K49R, V60I, D121Y, K122E, I135R, S162C, D177E, T200I, Q207G, R211K  
>90FAPR03| 07 | codons 1-220 | clone 07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIVALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 09 | codons 1-220 | clone 09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIDI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 10 | codons 1-220 | clone 10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVMDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 11 | codons 1-220 | clone 11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVMDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 12 | codons 1-220 | clone 12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVMDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 15 | codons 1-220 | clone 15
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 17 | codons 1-220 | clone 17
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVMDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| 20 | codons 1-220 | clone 20
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK
>90FAPR03| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007