<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU85 85FDEC03 Kenya 2003 HIV1 G Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V   K103N   P14S, I31L, V35T, E36D, D121H, K122E, I135L, S162A, K173T, Q174K, D177E, T200A, I202V, Q207E, R211K  
>85FDEC03| 07 | codons 1-220 | clone 07
PISPIETVPVKLKSGMDGPKVKQWPLTEEKLKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNTTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKK
>85FDEC03| 11 | codons 1-220 | clone 11
PISPIETVPVKLKSGMDGPKVKQWPLTEEKLKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPL
HEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKK
>85FDEC03| 12 | codons 1-220 | clone 12
PISPIETVPVKLKSGMDGPKVKQWPLTEEKLKALTDICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKK
>85FDEC03| 14 | codons 1-220 | clone 14
PISPIETVPVKLKSGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKK
>85FDEC03| 16 | codons 1-220 | clone 16
PISPIETVPVKLKSGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKK
>85FDEC03| codons 1-220
PISPIETVPVKLKSGMDGPKVKQWPLTEEKLKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007