<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU83 83MAUG04 Kenya 2004 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K103N   K20R, V35M, V60I, S68G, T69N, D121H, K122E, D123S, I135T, K173S, Q174K, D177E, T200A, Q207A, R211S  
>83MAUG04| 01 | codons 1-220 | clone 01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLVIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFYTPDKK
>83MAUG04| 06 | codons 1-220 | clone 06
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFYTPDKK
>83MAUG04| 07 | codons 1-220 | clone 07
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFYTPDKK
>83MAUG04| 09 | codons 1-220 | clone 09
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVELGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>83MAUG04| 10 | codons 1-220 | clone 10
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>83MAUG04| 12 | codons 1-220 | clone 12
PISPIETVPVNLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>83MAUG04| codons 1-220
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFYTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007