<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU79 79MJUN04 Kenya 2004 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 48
2 3TC+DDI+EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75M, M184V   K101E, Y181C, G190A   E28A, V35T, T39A, E40D, T69S, D121H, K122E, I135T, T139I, K173S, Q174K, D177E, I178V, V179I, T200A, Q207A, R211S  
>79MJUN04| 1 | codons 1-220 | clone 1
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVII
CQYVDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>79MJUN04| 2 | codons 1-220 | clone 2
PISPIETVPVKLEPGMDGPKVKQWPLTAEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVII
YQYVDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>79MJUN04| 12 | codons 1-220 | clone 12
PISPIEIVPVKLKPGMDGPKVKQWPLTAEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKSTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVII
YQYVDDLYVASDLQIGQHRAKIEELRAHLLSWGFTTPDKK
>79MJUN04| 22 | codons 1-220 | clone 22
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVII
CQYVDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>79MJUN04| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVII
CQYVDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007