<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU70 70MDEC03 Kenya 2003 HIV1 D Plasma MC

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 43
3 3TC+AZT+NVP 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K32N, V35M, T39A, K49R, V60I, I135R, S162C, T200I, Q207E, R211K  
>70MDEC03| 01 | codons 1-220 | clone 01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALMEICAEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKK
>70MDEC03| 02 | codons 1-220 | clone 02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALMEICAEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNKTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKK
>70MDEC03| 05 | codons 1-220 | clone 05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLEALMEICSEMEKEGKISRIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKK
>70MDEC03| 06 | codons 1-220 | clone 06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLEALMEICSEMEKEGKISRIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWDVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKK
>70MDEC03| 07 | codons 1-220 | clone 07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALMEICAEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNKTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKK
>70MDEC03| 08 | codons 1-220 | clone 08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNKTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKK
>70MDEC03| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALMEICAEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007