<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU62 62MMAR03 Kenya 2003 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E G190A   V35T, E40D, V60I, K101Q, V106I, K122E, D123G, K173S, Q174K, D177E, I178M, V179I, T200A, Q207A, R211S  
>62MMAR03| 2 | codons 1-220 | clone 2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEMII
YQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFFTPDEK
>62MMAR03| 3 | codons 1-220 | clone 3
PISPIETVPVKLKPEMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKRNSTRWRKLVDFRELNKRTQDFWEVQLGIRHPAGLQKKKSITVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEMII
YQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFITPDEK
>62MMAR03| 4 | codons 1-220 | clone 4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIII
YQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFITPDEK
>62MMAR03| 5 | codons 1-220 | clone 5
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIII
YQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFFTPDEK
>62MMAR03| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEMII
YQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFFTPDEK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007