<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU44 44MDEC03 Kenya 2003 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 13
3 AZT+DDI+EFV 83

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F V75M, K219Q K103N, G190A V108I V35T, T39A, S48T, V60I, D121H, K122E, I135T, K173L, Q174K, D177E, T200A, Q207A, R211K, F214L  
>44MDEC03| 1 | codons 1-220 | clone 1
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRAHLLKWGLFTPDQK
>44MDEC03| 2 | codons 1-220 | clone 2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYSAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEKLRAHLLKWGLFTPDQK
>44MDEC03| 3 | codons 1-220 | clone 3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRTHLLKWGLFTPDQK
>44MDEC03| 4 | codons 1-220 | clone 4
PISSIETVPVKLKPGMDGPKVKQWPLTEKKIKALTEICAEIKKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRKLNKRTQDFWEVQLGIPHPAGLKKNKSVTILNVGDAYFSVPL
HKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRAHLLKWGLFTPDQK
>44MDEC03| 6 | codons 1-220 | clone 6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRCQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRAHLLKWGLFTPDQK
>44MDEC03| 7 | codons 1-220 | clone 7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRAHLLKWGLFTPDQK
>44MDEC03| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRAHLLKWGLFTPDQK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007