<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU38 38MAUG04 Kenya 2004 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 78
2 3TC+DDI+EFV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E Y188L   V35T, T39M, V60I, V106I, L109I, K173E, D177E, G196E, T200A, Q207E, R211K, D218E  
>38MAUG04| 01 | codons 1-220 | clone 01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWGVQLGIPHPAGLKKKKSITVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK
>38MAUG04| 03 | codons 1-220 | clone 03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK
>38MAUG04| 04 | codons 1-220 | clone 04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMETEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK
>38MAUG04| 05 | codons 1-220 | clone 05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK
>38MAUG04| 06 | codons 1-220 | clone 06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK
>38MAUG04| 09 | codons 1-220 | clone 09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSVPL
DRDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPGIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK
>38MAUG04| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEIVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLWKWGFYTPEEK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007