<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU33 33FMAR03 Kenya 2003 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 17
2 AZT+DDI+EFV 73

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R   K103N   K11Q, V35T, V60I, K101Q, D121H, K122E, I135T, T139M, S162N, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S  
>33FMAR03| 8 | codons 1-220 | clone 8
PISPIETVPVQLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDQK
>33FMAR03| 10 | codons 1-220 | clone 10
PISPIATVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTHDFWEVQLGIPHPAGLKKNKSVTVLDXGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 13 | codons 1-220 | clone 13
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDQK
>33FMAR03| 15 | codons 1-220 | clone 15
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKTNSTRWRKLVDFRELNKRTQGLWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 16 | codons 1-220 | clone 16
PISPIETVPVQLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 17 | codons 1-220 | clone 17
PISPIETVPVQLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELYKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDQK
>33FMAR03| 18 | codons 1-220 | clone 18
PISPIETVPVQLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 19 | codons 1-220 | clone 19
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGLPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 20 | codons 1-220 | clone 20
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 21 | codons 1-220 | clone 21
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>33FMAR03| 23 | codons 1-220 | clone 23
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDQK
>33FMAR03| codons 1-220
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007