<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU30 30FAPR04 Kenya 2004 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 100
2 AZT+DDI+EFV 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, K219Q L100I, K103N   V35T, V60I, K122E, D123S, I135T, E138Q, K173L, Q174K, D177E, T200A, Q207A, R211S  
>30FAPR04| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDQK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007