<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYU30 30FMAR03 Kenya 2003 HIV1 A Plasma MC

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75E, F77L K103N   V35T, T39A, V60I, K122E, D123S, I135T, K173L, Q174K, D177E, T200A, Q207A, R211S D76I, W153R
>30FMAR03| 3 | codons 1-220 | clone 3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLEILRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGRKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>30FMAR03| 12 | codons 1-220 | clone 12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKIEILRELNKRTQDFLEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRRYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
>30FMAR03| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLEILRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGRKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK

References
Author Title Citation
Lwembe, R Anti-retroviral drug resistance-associated mutations among non-subtype B HIV-1-infected Kenyan children with treatment failure. J Med Virol, 2007