<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
J11238 SB_J11238 Saudi Arabia 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, V32I, K42KR, L101I, T112V, T124N, K136T, K173R, V201I, T206S, I208M, T218I, N222H, D229E, L234I, S255N, D256E, R269K S283G
>SB_J11238| codons 1-288
FLDGIDKAQEDHERYHSNWRAMASDFNLPPVIAKEIVASCDRCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLRTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDMQTKELQKQIIKIQHFRVYYRESRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIKDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Badreddine, S Identification and characterization of HIV type 1 subtypes present in the Kingdom of Saudi Arabia: High level of genetic diversity found. ARHR, 2007