<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH133 MR_CH133 Chile 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 ABC+DDI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y   G190A A98G K43Q, K122E, D123N, I135T, I142V, Q174H, I178M, T200A, Q207E, R211K, V245M  
>MR_CH133| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDMVI
YQYVDDLYVASDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F, L89V I15V, L19I, M36I, R57K, L63P, I93L  
>MR_CH133| codons 1-99
PQITLWQRPFVTIKVGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNVLTQLGCTLNF

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007