<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH99 MR_CH99 Chile 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+DDI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V   Y181C   K49R, V106I, D123E, A158P, K166T, E169K, K173E, D177E, T200A, H221Y, E224D, V245K, A272P E40T, I167L, Q174P
>MR_CH99| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTTLEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPPIFQSSMTTLLKPFREPNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKYQKDPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, L33V, L63P, E65Q, L89M  
>MR_CH99| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIQICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007