<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH75 MR_CH75.1 Chile 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 AZT+DDI+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E L10I, K20R, E35D, M36I, I62V, L63P, A71V I93S
>MR_CH75.1| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVREYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQSGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W D67H K101E   K43E, W88C, V118I, S162H, E169K, D177E, I178L, G196E, R211A, V245Q, A272P N57I
>MR_CH75.1| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYITPV
FAIKKKHSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILKPFRKQNPELVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVK

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007