<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRAM-24 BRAM-24 Brazil 1997 HIV1 D PBMC Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, R41K, L63P, I64L  
>BRAM-24| codons 8-92
RPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYDQIPLEIC
GHKAIGTVLVGPTPVNIIGRNLLTQ

References
Author Title Citation
Tanuri, A Genetic variation and susceptibilities to protease inhibitors among subtype B and F isolates in Brazil. AAC, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005