<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRAM-27 BRAM-27 Brazil 1997 HIV1 B PBMC Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, M36I, L63P, I72T, Q92H I85S
>BRAM-27| codons 8-92
RPLVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQIPIEIC
GHKATGTVLVGPTPVNISGRNLMTH

References
Author Title Citation
Tanuri, A Genetic variation and susceptibilities to protease inhibitors among subtype B and F isolates in Brazil. AAC, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005