<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRAM-29 BRAM-29 Brazil 1997 HIV1 F PBMC Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12M, E35D, M36I, R41K, D60E, Q61N, K70R, V77I, L89M R57Q, I85N
>BRAM-29| codons 8-92
RPLVMIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVQQYENILIEIC
GHRAIGTVLIGPTPVNINGRNMLTQ

References
Author Title Citation
Tanuri, A Genetic variation and susceptibilities to protease inhibitors among subtype B and F isolates in Brazil. AAC, 1999