<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH37 MR_CH37.1 Chile 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 3TC+DDI+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L10LV, T12TA, I13V, K14KR, I15IV, K20T, E35D, M36I, R41K, K45Q, R57K, Q61N, L63P, T74S  
>MR_CH37.1| codons 1-99
PQITLWQRPVVAVRVGGQLTEALLDTGADNTVLEDINLPGKWKPQMIGGIGGFIKVKQYD
NIPIEICGHKAIGSVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, M184V     Y181F V35K, E36D, T39A, V60I, S68N, V90I, K122KE, I135C, S162Y, H221Y, D250E, A272P  
>MR_CH37.1| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKDICAEMEKEGKISKIGPENPYNTPI
FAIKKKDNTGWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSCNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
FQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVK

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007