<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH35 MR_CH35 Chile 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103S, G190A A98G K49R, V60I, R83K, K122E, E169D, R172RK, T200A, Q207E, L228R, A272P  
>MR_CH35| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKSKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFKKQNPDIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLWRWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18I, R41K, L63P, I72V, V77I, I93L  
>MR_CH35| codons 1-99
PQITLWQRPLVTIKIGGILKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007