<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH32 MR_CH32.1 Chile 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 AZT+DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K32Q, V35I, K43N, E44D, K101R, D123E, I135L, G196E, R211K, A272P, K277R K46N
>MR_CH32.1| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIQALIEICTELENDGNISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2P, L10I, T12P, I13V, K14R, K55KR, L63P, I64V, H69N, V77I  
>MR_CH32.1| codons 1-99
PPITLWQRPIVPVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIRVRQYD
QIPVEICGNKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007