<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH18 MR_CH18.1 Chile 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 D4T+DDI+IDV NA
3 D4T+DDI+IDV+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A Q58E I15V, E35D, M36I, L63P  
>MR_CH18.1| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVREYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N P225H D177G, T200A, I202V, L210F, R211K, V245T  
>MR_CH18.1| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQHLFKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVK

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007