<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH17 MR_CH17 Chile 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+AZT+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, T12P, L19I, E35D, M36I, N37H, P39Q, K45R, R57K, L63P, I64V, A71T, I93L  
>MR_CH17| codons 1-99
PQITLWQRPIVPIKIGGQIKEALIDTGADDTVLEDIHLQGRWKPRMIGGIGGFVKVKQYD
QIPVEICGHKTIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y V75M, F77L     E6K, E40D, K122E, I142V, S162D, E169D, E203D, R211K, A272P, K277R  
>MR_CH17| codons 1-277
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTDLEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQDSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVR

References
Author Title Citation
Rios, M Antiretroviral drug resistance and phylogenetic diversity of HIV-1 in Chile. J Med Virol, 2007