<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NVP-16 16-M2 India 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   V35T, E36A, T39E, S48T, V60I, D121Y, K122E, I135R, S162C, K173A, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, Q334H, G335E, R356K, G359T K13KE
>16-M2| codons 1-365
PISPIETVPVKLEPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHEQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDV

References
Author Title Citation
Kurle, SN Emergence of NNRTI drug resistance mutations after single-dose nevirapine exposure in hiv type 1 subtype C infected infants in India. ARHR, 2007