<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV_KTB035 02.KTB035 DRC 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A, A128T K7E, E10A, S17N, V31I, I72V, I84M, L101I, T112V, T125A, I135V, K136Q, V201I, I217V, T218L, L234I, D256E, D279G S283G
>02.KTB035| codons 1-288
FLDGIDEAQAEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQEAAYFILKLAGRWPVKVIHTDNGSN
FTSTAVKTACWWAGVQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQVLKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDGCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, E35D, M36I, N37D, R41K, H69K, L89M  
>02.KTB035| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, T27S, V35T, T39R, V60I, K122E, D123N, I135T, S162C, K173S, Q207N, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294T, V317E, I326V, Q334H, G335D, R356K, M357K, G359S, K366R, A371V, I375V, T377V, K390R, T403M, E404D, E432D, D471E, Q480H, H483Y, K512R, L517I, S519N, Q524K, K527E, V531I, A534S, Q547K, A554S  
>02.KTB035| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLSEEKIKALTEICREMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRSQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGEYYDPSKDLVAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKVAVESIVIWGKTPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEKLIEKEKIYLSWVPAHK
GIGGNEKVDKLVSSGIRKVL

References
Author Title Citation
Vidal, N Identification and molecular characterization of subsubtype A4 in Central Africa. ARHR, 2006