<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KTB13 97.KTB13 DRC 1997 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A K14R, A21T, I72V, L101I, T112V, T124A, T125A, G134N, K136Q, L234I S283G
>97.KTB13| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, H69K, L89M  
>97.KTB13| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D123G, T139A, K173A, Q174K, I178M, T200A, Q207D, R211K, V245Q, A272P, T286A, I293V, P294E, D324E, G335D, R356K, M357K, G359S, K366R, I375V, T377L, K390R, T403M, E404D, E432D, V435A, A437V, D471E, Q480H, H483Y, L491S, A502V, K512R, E516G, S519N, Q524K, K527E, A534S, A554S  
>97.KTB13| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVELTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEAVQKVALESIVIWGKTPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGVETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYVLGIIQAQPDRSESGLVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Vidal, N Identification and molecular characterization of subsubtype A4 in Central Africa. ARHR, 2006