<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KCC2 97.KCC2 DRC 1997 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, I15V, G16E, E35D, M36I, R41K, R57K, H69K, L89M  
>97.KCC2| codons 1-99
PQITLWQRPVVTVRVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, V35T, T39N, V60I, K64R, K122A, D123N, I135T, S163T, K173S, Q174K, D177E, T200A, Q207A, R211K, V245Q, A272P, K281R, L283I, T286A, E291D, V292I, I293V, P294T, R356K, M357K, G359S, K366R, T369S, A371V, I375V, K390R, T403M, E404D, E432D, D471E, Q480H, H483Y, L491S, K512I, L517I, S519N, Q524K, K527E, A534S, A554S  
>97.KCC2| codons 1-560
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DANFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLIRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLSEVVQKVATESIVIWGKTPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDISESEIVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, I72V, L101I, T112V, T125A, G134S, K136Q, D167E, I208L, L234I S283G
>97.KCC2| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSTAVKAACWWASIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDLQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Vidal, N Identification and molecular characterization of subsubtype A4 in Central Africa. ARHR, 2006