<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYIDUA6 04MYIDUA6 Malaysia 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E34EK, E35D, M36I, K55KR, L63P, H69K, L89M  
>04MYIDUA6| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLKDINLPGRWKPKMIGGIGGFIRVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, D123N, I135R, K173IT, Q174K, D177E, I178M, I202V, Q207A, R211N, V245E  
>04MYIDUA6| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKD

References
Author Title Citation
Tee, KK The evolving molecular epidemiology of HIV type 1 among injecting drug users (IDUs) in Malaysia. ARHR, 2005