<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-230 G-230 Ethiopia 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, G16E, L19M, M36I, R41K, L63T, E65D, K70R, I72T, I93L  
>G-230| codons 1-99
PQITLWQRPLVPIKIEGQMKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIDICGHRATGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75I     V35T, T39A, E40D, K49R, V60I, D121H, K122E, K126R, I132L, I135V, S162C, S163T, T165I, D177E, I178V, Q207E, F214L, V245K, D250E  
>G-230| codons 1-266
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRRYTAFTLPSVNNETPGIRYQYNVLPQGWKGSPAIFQCTMIKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNW

References
Author Title Citation
Kassu, A Molecular epidemiology of HIV-1 in treatment-naive patients in North Ethiopia. ARHR, 2007