<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-139 G-139 Ethiopia 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, K14KR, I15V, M36I, R41K, L63T, H69K, V82I, L89M, I93L  
>G-139| codons 1-99
PQITLWQRPLVAIRVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35T, E36A, T39E, E40D, K49KR, K122E, D123S, A158S, K173T, Q174K, D177E, V179I, T200A, Q207E, R211K, V245Q, E248D, K249Q  
>G-139| codons 1-266
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDQDSWTVNDIQKLVGKLNW

References
Author Title Citation
Kassu, A Molecular epidemiology of HIV-1 in treatment-naive patients in North Ethiopia. ARHR, 2007