<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-135 G-135 Ethiopia 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, I15IV, L19I, M36I, N37T, R41K, L63T, H69K, V82I, L89M, I93L  
>G-135| codons 1-99
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEITLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A   V35T, E36A, T39E, E40D, K49R, I50IV, K122E, A158S, K173A, Q174N, V179I, T200A, Q207E, R211K, V245Q  
>G-135| codons 1-266
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKISRVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRANNPDIII
YQYMDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNW

References
Author Title Citation
Kassu, A Molecular epidemiology of HIV-1 in treatment-naive patients in North Ethiopia. ARHR, 2007