<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-079 G-079 Ethiopia 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>G-079| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60VI, K122E, D123N, I135T, I142V, K173S, D177E, V179I, T200TA, Q207AD, V245Q, E248DN E29ED
>G-079| codons 1-266
PISPIETVPVKLKPGMDGPKVKQWPLTEDKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNW

References
Author Title Citation
Kassu, A Molecular epidemiology of HIV-1 in treatment-naive patients in North Ethiopia. ARHR, 2007