<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-068 G-068 Ethiopia 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, G16E, K20KR, M36I, N37T, P39S, L63C, H69K, L89M  
>G-068| codons 1-99
PQITLWQRPVVTIKVEGQLREALLDTGADDTVLEEITLSGRWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, T39D, K49R, I50IV, A98S, K101Q, K122E, D123S, I135R, K173A, D177E, T200A, Q207NS, R211RK, V245Q  
>G-068| codons 1-266
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICDEMEKEGKISRVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLQKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRSHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNW

References
Author Title Citation
Kassu, A Molecular epidemiology of HIV-1 in treatment-naive patients in North Ethiopia. ARHR, 2007